Chromobacterium haemolyticum: CH06BL_43510 Help Entry CH06BL_43510      CDS       T06734                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism chae  Chromobacterium haemolyticum Pathway chae03060   Protein export chae03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:chae00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CH06BL_43510  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CH06BL_43510  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:chae02044]     CH06BL_43510 Secretion system [BR:chae02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CH06BL_43510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Ni_hydr_CYTB Motif Other DBs NCBI-ProteinID:  BBH15103 LinkDB All DBs Position complement(4777398..4777607) Genome browser AA seq 69 aa AA seqDB search MGSFSIWHWLVVLLIVVLVFGTKKLRNIGEDLGGAVKGFKEGMNGENDKAAKDKPAETGR IIDGDADKK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgggttctttcagcatctggcactggctggtggtattgctgatcgtggtgctggtgttc ggcaccaagaaactgcgcaatatcggcgaggatctgggcggcgccgttaaaggcttcaag gaaggcatgaacggcgagaacgacaaggccgccaaggataagccggccgaaaccggccgt atcatcgacggcgacgccgacaagaaataa

DBGET integrated database retrieval system