Caldicellulosiruptor hydrothermalis: Calhy_1073 Help Entry Calhy_1073        CDS       T01346                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism chd  Caldicellulosiruptor hydrothermalis Pathway chd02020   Two-component system chd02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:chd00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Calhy_1073  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Calhy_1073  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:chd02035]     Calhy_1073 Bacterial motility proteins [BR:chd02035]  Flagellar system   Flagellar assembly proteins    Others     Calhy_1073 SSDB OrthologParalogGFIT Motif Pfam:  FlgM MRX4_C YibD_C Motif Other DBs NCBI-ProteinID:  ADQ06800 UniProt:  E4Q8F5 LinkDB All DBs Position 1089100..1089387 Genome browser AA seq 95 aa AA seqDB search MRIEDRMRIFQIYSQTAKVTRVEKKQEPTATDKVEISSEARDFQAVLNAIKLTPDVREEK VNEIKKKIDSGTYNVSGKDVVEKLIREYKASKKNE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaggatagaagatagaatgaggatatttcagatttacagccaaacagcaaaagtaacc agagtcgaaaagaagcaggaacctactgcaactgataaggttgaaatatcaagcgaggca agagattttcaagctgttttgaatgctataaagctcacacctgatgttcgtgaagagaag gtaaatgagataaaaaagaagattgactctggcacatacaatgtatctggaaaagatgtt gttgaaaaacttataagagaatacaaagcttcaaaaaagaacgagtaa

DBGET integrated database retrieval system