Chelativorans sp. AA-79: PVE73_16110 Help Entry PVE73_16110       CDS       T09422                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chea  Chelativorans sp. AA-79 Pathway chea01100   Metabolic pathways chea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PVE73_16110    00074 Mycolic acid biosynthesis     PVE73_16110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PVE73_16110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WEX07626 LinkDB All DBs Position complement(3294513..3294749) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIEKATA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatactgcagagcgcgtcaagaaaatcgttgtcgagcatctcggcgtggacgcc gacaaggtgaccgaacaggccagcttcatcgacgatctgggcgccgacagcctcgacacc gttgagctggtcatggcttttgaggaagaattcggcgttgaaattcccgacgatgcggcc gagaccatcctgacggtcggcgacgccgtgaaatacatcgaaaaggccaccgcctga

DBGET integrated database retrieval system