Chelatococcus sp. CO-6: AL346_18445
Help
Entry
AL346_18445 CDS
T04040
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
chel
Chelatococcus sp. CO-6
Pathway
chel02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
chel00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
AL346_18445
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
chel02000
]
AL346_18445
Enzymes [BR:
chel01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
AL346_18445
Transporters [BR:
chel02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
AL346_18445
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_29
AAA_23
AAA_22
SMC_N
AAA_16
ABC_ATPase
RsgA_GTPase
AAA_15
AAA_30
AAA_18
AAA_25
Adeno_IVa2
nSTAND1
AAA_28
MMR_HSR1
AAA_19
AAA_33
Mg_chelatase
NB-ARC
AAA_5
SpoIVA_ATPase
AAA_24
ORC-CDC6-like
Motif
Other DBs
NCBI-ProteinID:
ALA19027
LinkDB
All DBs
Position
3936663..3937460
Genome browser
AA seq
265 aa
AA seq
DB search
MTHAASAATPAEGSAGLLAIRHLRKEYRAGQPVLKDISLDIEGRGVTAIIGPSGTGKSTL
IRCINRLVDPTSGEIWFEGRDLARLRGDALRLARRRIGMVFQEYNLVERLSVIENVLSGR
LGYVPAWRAFLRRFPADDVARAFDLIDAVGLGEDFATRRADQLSGGQRQRVGIARAIMQS
PGLILADEPTSSLDPKTSVEIMELMAQISRERSIPIVINIHNVELARRYAQRIIGMSRGE
VVYDGSPDGLGDSHLKEIYGGEDWL
NT seq
798 nt
NT seq
+upstream
nt +downstream
nt
atgacacatgctgcgtccgccgcaacgcccgccgagggatcggccggccttctcgccatc
cgtcatctgcgcaaggaataccgggccggccagccggtgctcaaggacatctcgctcgac
atcgaggggcggggcgtcaccgccatcatcgggccttccggcaccggcaagtcgaccctc
atccgctgcatcaaccggctggtcgatccgacctcgggcgagatctggttcgaaggccgc
gacctcgcgcgcctgcgcggtgatgcgctccggctcgcgcgccggcgcatcggcatggtg
ttccaggagtacaatctcgtcgagcgcctcagcgtcatcgagaacgtgctgtcggggcgg
ctcggctacgtgcctgcctggcgtgccttcctgcgccggttcccggccgacgacgtggca
cgcgccttcgacctcatcgatgccgtgggcctcggcgaggacttcgccacgcggcgggcc
gaccagctctccggcgggcagcgccagcgcgtgggcatcgcccgcgccatcatgcaatcg
cccggcctgatcctcgccgacgagcccacgtcctcgctggatcccaagacctccgtcgag
atcatggaactgatggcgcagatttcccgcgagcgctccattcccatcgtcatcaacatc
cacaatgtcgagctcgcccgccgctatgcgcagcgcatcatcggcatgtcgcgcggcgag
gtggtctatgacggctcgcctgacggcctcggcgacagccacctgaaggagatctacggc
ggggaggactggctatga
DBGET
integrated database retrieval system