Chitiniphilus purpureus: N8I74_09030 Help Entry N8I74_09030       CDS       T08496                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chic  Chitiniphilus purpureus Pathway chic00998   Biosynthesis of various antibiotics chic01100   Metabolic pathways chic01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chic00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N8I74_09030    00074 Mycolic acid biosynthesis     N8I74_09030   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N8I74_09030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF5798 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  UXY17132 LinkDB All DBs Position 1934243..1934494 Genome browser AA seq 83 aa AA seqDB search MEDGIQTLVNQLLVEISGTRKTIAPTKHLVEDLGFDSLKMVDLMMAIEERFDVAIPVADA TRIRTVSDLYQAIARVANAPFPA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggaagacggtattcagacgctggtgaatcaactgctggtggagatcagcgggacgcgc aagaccatcgcgccgaccaagcatctcgtggaagacctcggttttgattcgctgaagatg gtcgatctgatgatggcgatcgaagagcgcttcgacgtcgccattccggtggcggatgcc acccggatccgcaccgtctccgacctttaccaagcaatcgcgcgtgtcgccaacgcgccc tttccggcctga

DBGET integrated database retrieval system