Colletotrichum higginsianum: CH63R_00037 Help Entry CH63R_00037       CDS       T08176                                  Name (RefSeq) DSS1/SEM1 family protein   KO K10881   26 proteasome complex subunit DSS1 Organism chig  Colletotrichum higginsianum Pathway chig03050   Proteasome chig03440   Homologous recombination Brite KEGG Orthology (KO) [BR:chig00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     CH63R_00037   09124 Replication and repair    03440 Homologous recombination     CH63R_00037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:chig03019]     CH63R_00037    04131 Membrane trafficking [BR:chig04131]     CH63R_00037    03051 Proteasome [BR:chig03051]     CH63R_00037    03400 DNA repair and recombination proteins [BR:chig03400]     CH63R_00037 Messenger RNA biogenesis [BR:chig03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      CH63R_00037 Membrane trafficking [BR:chig04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     CH63R_00037 Proteasome [BR:chig03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      CH63R_00037 DNA repair and recombination proteins [BR:chig03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      CH63R_00037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  28859119 NCBI-ProteinID:  XP_018163374 UniProt:  A0A1B7YS41 LinkDB All DBs Position 1:complement(129735..130336) Genome browser AA seq 98 aa AA seqDB search MASSDAKPAQDKTADLKADETTAQQQQAAAKKPALGEDDEFEDFPVDDWPQEETEAAAGG SGSTQHLWEESWDDDDTSDDFSAQLKEELKKVEASKRR NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcatcttcggacgcaaagcccgcgcaggacaagaccgccgaccttaaggccgacgag acgacggcgcagcagcagcaggccgccgccaagaagcccgcgctcggcgaggacgacgag ttcgaggacttccccgttgacgactggccccaggaagagaccgaggcggccgccggcggg agcggctcgacgcagcacctttgggaagagagctgggacgacgacgacacgagcgacgac ttctctgcgcaactgaaggaggagctgaagaaagtcgaggcctccaagagacgatga

DBGET integrated database retrieval system