Colletotrichum higginsianum: CH63R_05882 Help Entry CH63R_05882       CDS       T08176                                  Name (RefSeq) Sec61beta family protein   KO K09481   protein transport protein SEC61 subunit beta Organism chig  Colletotrichum higginsianum Pathway chig03060   Protein export chig04141   Protein processing in endoplasmic reticulum chig04145   Phagosome Brite KEGG Orthology (KO) [BR:chig00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CH63R_05882    04141 Protein processing in endoplasmic reticulum     CH63R_05882  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CH63R_05882  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chig04131]     CH63R_05882   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:chig02044]     CH63R_05882 Membrane trafficking [BR:chig04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     CH63R_05882 Secretion system [BR:chig02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    CH63R_05882 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  28864964 NCBI-ProteinID:  XP_018158707 UniProt:  A0A1B7YE44 LinkDB All DBs Position 4:1910014..1910751 Genome browser AA seq 114 aa AA seqDB search MSSPRPSSPVNAPGAAASGASVARPSSPTPPGGPRTAIRRRAAADQKEKIANARPNSTRA AGAGGSSSTMLRLYTDESPGLKVDPVVVLVLSLVFIFSVVALHIIAKITRKFSS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtcttcccctcgcccttcctcgcccgttaacgcgcccggcgccgccgcctccggcgcg agcgttgcgcgcccttcgtcacctactccccccggtggcccccgcactgccattcgtcgc cgcgccgccgccgatcagaaggagaagattgcgaatgcgcggccgaacagcacgagagct gccggtgccggtggcagcagcagcaccatgctgagactctacaccgacgagtctcctggt ctcaaggtcgaccccgtcgttgttctggttctttcccttgttttcattttcagcgttgtt gctcttcacatcattgccaagattacccgcaagttctcgtcttaa

DBGET integrated database retrieval system