Colletotrichum higginsianum: CH63R_06634 Help Entry CH63R_06634       CDS       T08176                                  Name (RefSeq) Replication factor A protein 3   KO K10740   replication factor A3 Organism chig  Colletotrichum higginsianum Pathway chig03030   DNA replication chig03420   Nucleotide excision repair chig03430   Mismatch repair chig03440   Homologous recombination chig03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:chig00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     CH63R_06634    03420 Nucleotide excision repair     CH63R_06634    03430 Mismatch repair     CH63R_06634    03440 Homologous recombination     CH63R_06634    03460 Fanconi anemia pathway     CH63R_06634  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:chig03032]     CH63R_06634    03400 DNA repair and recombination proteins [BR:chig03400]     CH63R_06634 DNA replication proteins [BR:chig03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     CH63R_06634 DNA repair and recombination proteins [BR:chig03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      CH63R_06634    MMR (mismatch excision repair)      CH63R_06634   DSBR (double strand breaks repair)    HR (homologous recombination)      CH63R_06634 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rep_fac-A_3 UfSP_MPN_N Motif Other DBs NCBI-GeneID:  28865716 NCBI-ProteinID:  XP_018159459 UniProt:  H1VDY5 LinkDB All DBs Position 4:4407398..4408012 Genome browser AA seq 108 aa AA seqDB search MAEPTSTPRITAQYLDSYVGRNVMLVGKVLQLRGDSAVLDADGNVTAILNRDVHLTNGNA AQIIGKVNPDLSIKVLSSRDLGPDVDFQLAAAVVEATHHHKSLFVFDN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggccgaacccacgtccaccccgcgcatcacggcccagtacctcgacagctacgtcggc cgcaacgtcatgcttgtcggcaaggtcctgcagctgcgcggggactctgccgtcctcgat gccgacggcaacgttacggccatcctcaaccgcgatgttcacctcaccaatggcaacgct gcccagatcatcggcaaagtcaaccccgatctgtccatcaaagtgcttagctcccgtgat ctgggacccgatgttgacttccaactcgccgccgccgtcgtcgaggcgacacaccatcac aagtccctcttcgtcttcgacaactga

DBGET integrated database retrieval system