Colletotrichum higginsianum: CH63R_10096 Help Entry CH63R_10096       CDS       T08176                                  Name (RefSeq) GTP-binding protein rhoA   KO K04513   Ras homolog gene family, member A Organism chig  Colletotrichum higginsianum Pathway chig04011   MAPK signaling pathway - yeast chig04081   Hormone signaling chig04144   Endocytosis chig05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:chig00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     CH63R_10096   09133 Signaling molecules and interaction    04081 Hormone signaling     CH63R_10096  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     CH63R_10096  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CH63R_10096  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chig04131]     CH63R_10096   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chig04147]     CH63R_10096    04031 GTP-binding proteins [BR:chig04031]     CH63R_10096 Membrane trafficking [BR:chig04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     CH63R_10096 Exosome [BR:chig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CH63R_10096   Exosomal proteins of other body fluids (saliva and urine)    CH63R_10096   Exosomal proteins of colorectal cancer cells    CH63R_10096   Exosomal proteins of bladder cancer cells    CH63R_10096 GTP-binding proteins [BR:chig04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     CH63R_10096 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB DUF6990 Motif Other DBs NCBI-GeneID:  28869177 NCBI-ProteinID:  XP_018154494 UniProt:  H1VK36 LinkDB All DBs Position 7 Genome browser AA seq 195 aa AA seqDB search MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCQGLPIILVGCKKD LRYDSKTIEELRKTSQKPVSPEEGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALL SRSRSSGKKHKCMIL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atggctgagatccgccgtaagctcgtcatcgtcggcgacggtgcctgtggtaaaacttgc ttgttgatcgtcttctctaagggtacattccctgaggtctacgtccccaccgttttcgag aactacgtcgccgatgtcgaggttgacggcaagcacgtcgagctggccctttgggatact gccggccaggaggactacgatcgtctccgccccctttcctaccccgactcccacgtcatc ctgatctgcttcgccgtcgactcccccgactccctggacaacgttcaggagaagtggatc tccgaggttctgcacttctgccagggcctgcccatcattctcgtcggctgcaagaaggat ctccgctacgactccaagacgattgaagagctgcgtaagaccagccagaagcccgtctcc cccgaggagggtgaggaagtccgcaagaagatcggcgcctacaagtacctcgagtgctcc gccaagacgaacgagggcgtccgcgaggttttcgagcacgccacgcgcgctgctctgctc tcccgcagccggagcagcggcaagaagcacaagtgcatgattctctaa

DBGET integrated database retrieval system