Chitinophaga sp. MD30: CK934_02690 Help Entry CK934_02690       CDS       T10354                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chim  Chitinophaga sp. MD30 Pathway chim00998   Biosynthesis of various antibiotics chim01100   Metabolic pathways chim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CK934_02690    00074 Mycolic acid biosynthesis     CK934_02690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CK934_02690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF2624 Motif Other DBs NCBI-ProteinID:  ASZ09962 LinkDB All DBs Position complement(729664..729900) Genome browser AA seq 78 aa AA seqDB search MSDIASRVKKIIIDKLGVDEAEVTPEASFTNDLGADSLDTVELIMEFEKEFNISIPDEQA ETITTVGQAVAYLEEHVK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagacattgcatcaagagttaaaaagatcatcattgacaaattgggcgttgacgaa gccgaggtaactcctgaagccagcttcaccaatgacttaggcgctgactctttggatacg gtagaactgattatggaattcgaaaaagaattcaacatctccattcctgacgaacaagct gaaactattactactgttggccaggctgtagcttacctggaagaacatgtaaaataa

DBGET integrated database retrieval system