Chitinophaga sp. MD30: CK934_11070 Help Entry CK934_11070       CDS       T10354                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chim  Chitinophaga sp. MD30 Pathway chim00998   Biosynthesis of various antibiotics chim01100   Metabolic pathways chim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CK934_11070    00074 Mycolic acid biosynthesis     CK934_11070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CK934_11070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ASZ11457 LinkDB All DBs Position 2722107..2722364 Genome browser AA seq 85 aa AA seqDB search MDIKEVIKRTNAFLVEEFEAEPAAITPSANLKATLELDSLDYIDLVVVIENNFGFKVNPE DFQSIITFQHFYDYVLARVKQKELV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggatattaaagaagtaataaaacgaacaaatgctttcctggtagaggaatttgaggct gaacctgcagccattacgccaagtgccaacctgaaagctaccctggaactggatagtttg gattacatcgatctcgttgtcgtgatcgaaaacaactttggtttcaaagtaaatccggaa gatttccagagcattatcaccttccagcatttctacgattacgtgctggctcgtgtaaaa caaaaagaactggtgtaa

DBGET integrated database retrieval system