Corynebacterium hindlerae: J5O04_05220 Help Entry J5O04_05220       CDS       T08794                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism chin  Corynebacterium hindlerae Brite KEGG Orthology (KO) [BR:chin00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     J5O04_05220 Enzymes [BR:chin01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      J5O04_05220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_2 Glrx-like Thioredoxin_9 SH3BGR Thioredoxin Motif Other DBs NCBI-ProteinID:  QTH60512 LinkDB All DBs Position complement(1101316..1101564) Genome browser AA seq 82 aa AA seqDB search MADFKIYTTEWCPFCQKLVAALDEANIPYTRIDVEEDAEAAAWVESVNGGDRIVPTVVYP DGSHATNPQPKVAVRKYTRLTS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctgatttcaagatttataccaccgagtggtgcccgttctgccagaagctggtcgca gctttggacgaggcgaacatcccctacacccggatcgatgtggaggaggacgcggaggcg gccgcgtgggtggagtccgtcaatggcggcgaccggatcgtaccgacggtcgtgtacccg gacggttctcacgcgacgaacccgcagcctaaggtggccgtgcgaaagtacacccggctt acttcctaa

DBGET integrated database retrieval system