Chitinophaga sp. XS-30: FW415_04900 Help Entry FW415_04900       CDS       T06207                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism chit  Chitinophaga sp. XS-30 Brite KEGG Orthology (KO) [BR:chit00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:chit03032]     FW415_04900    03036 Chromosome and associated proteins [BR:chit03036]     FW415_04900    03400 DNA repair and recombination proteins [BR:chit03400]     FW415_04900 DNA replication proteins [BR:chit03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FW415_04900 Chromosome and associated proteins [BR:chit03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FW415_04900 DNA repair and recombination proteins [BR:chit03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FW415_04900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-DNA_bdg HU-CCDC81_euk_1 IF2_N Motif Other DBs NCBI-ProteinID:  QEH40244 UniProt:  A0A5B9WIW4 LinkDB All DBs Position complement(1164758..1165027) Genome browser AA seq 89 aa AA seqDB search MNKAELIDKLAKDAGVTKTQANDALDSFTKAVADTLKKGGKVTLVGFGTFSVSKRAARNG RNPQTGQIIKIKAKKVAKFKAGKALSDKL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagccgaattgatcgacaaactcgccaaagatgctggcgttactaaaacacaa gctaacgatgctttggattctttcactaaagctgttgctgataccctgaaaaaaggtggt aaagtaactttggttggtttcggtactttctctgtttccaaacgtgctgcacgtaacggt agaaacccccagactggccagatcatcaagatcaaagctaagaaagttgctaaattcaaa gctggtaaagcactgtctgacaagctctag

DBGET integrated database retrieval system