Chitinophaga sp. XS-30: FW415_05870 Help Entry FW415_05870       CDS       T06207                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chit  Chitinophaga sp. XS-30 Pathway chit01100   Metabolic pathways chit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FW415_05870    00074 Mycolic acid biosynthesis     FW415_05870   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FW415_05870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF2624 Motif Other DBs NCBI-ProteinID:  QEH40423 LinkDB All DBs Position 1391161..1391397 Genome browser AA seq 78 aa AA seqDB search MSDIASRVKKIIIDKLGVDEAEVTPEASFTNDLGADSLDTVELIMEFEKEFNISIPDEQA ETITTVGQAVAYLEEHVK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagacattgcatcaagagttaaaaagatcattatcgacaaattaggcgttgacgag gccgaggtaactcctgaagccagctttaccaacgacttaggcgctgactctttggatact gtagaactgatcatggaattcgaaaaagaattcaacatctccattcctgacgaacaagca gagactatcaccactgttggccaggcagttgcttacctggaagaacacgtaaaataa

DBGET integrated database retrieval system