Chitinophaga sp. XS-30: FW415_11065 Help Entry FW415_11065       CDS       T06207                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chit  Chitinophaga sp. XS-30 Pathway chit01100   Metabolic pathways chit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FW415_11065    00074 Mycolic acid biosynthesis     FW415_11065   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FW415_11065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEH41391 LinkDB All DBs Position 2686719..2686976 Genome browser AA seq 85 aa AA seqDB search MEINEIIKKTNAFLAEEFEVAPESITPGADLKATLELDSLDYIDLVVAIENNFGFKVKPE DFQGIVTFQDFYDYVIARIKQKELV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaaattaacgagatcatcaaaaaaacgaacgctttcctggcagaggaatttgaggtt gctcccgaaagcattacccccggggcggacctgaaagccacgttggaactggatagtctg gattatatagacctggtggtagccattgagaataatttcggttttaaggtaaaaccggaa gatttccagggtattgtcactttccaggacttttacgattatgtcattgcccgtattaaa caaaaagaactggtataa

DBGET integrated database retrieval system