KEGG   Cardiobacterium hominis: NCTC10426_00063
Entry
NCTC10426_00063   CDS       T05791                                 
Symbol
cysW_2
Name
(GenBank) Sulfate transport system permease protein CysW
  KO
K02047  sulfate/thiosulfate transport system permease protein
Organism
chj  Cardiobacterium hominis
Pathway
chj00920  Sulfur metabolism
chj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:chj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NCTC10426_00063 (cysW_2)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NCTC10426_00063 (cysW_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:chj02000]
    NCTC10426_00063 (cysW_2)
Transporters [BR:chj02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    NCTC10426_00063 (cysW_2)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: VEG76060
LinkDB
Position
1:87350..88135
AA seq 261 aa
MRRLLIALALAFVLLFLVLPLAVVFHGAFAKGWATFAAALAEVDTRHALWLTLLVTAITV
PVNVIFGVAFAWLVTRFRFRGRALLITLLDIPFAVSPVIAGLLYLLLYGANSPLGAWFAA
HNLQLMFAVPGIVLVTVFVTCPFVARELIPFMQQHGAAEEEAAVVLGASRWQLWRRITLP
TILWPLLYGVALTNARAVGEFGAVSVVSGNIRGETNTLPLNVELLYQDYQAAAAFASAVL
LVLIALATLALKTWVARKEHA
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagacgcctcttgattgccctcgcgctcgccttcgtgctgctctttctcgtgctgccg
ctggccgtcgtcttccacggcgcgtttgccaaaggctgggcgacctttgccgctgccctc
gccgaggtggacacccgccacgccctctggctgaccctgctcgttaccgccattaccgta
ccggtgaacgtcatcttcggcgtcgccttcgcctggctcgttacccgcttccgcttccgt
ggccgcgcgctgctcattaccctgctcgatattccctttgccgtctcgccagtcatcgcc
ggtctgctctatcttttgctttacggcgcgaacagcccgctcggcgcatggttcgccgcg
cacaacctgcaactgatgttcgccgtgccgggtatcgtcctcgtcaccgttttcgtgact
tgcccgttcgtcgcgcgcgaactcatccccttcatgcagcaacacggcgcggcggaagaa
gaagcggcggtcgtcctcggcgccagccgctggcaactgtggcggcgcatcaccctgccg
accatcctctggccgctgctttatggcgtggcgctgaccaacgcgcgcgcggtgggcgaa
tttggcgcggtttccgtcgtctccggcaacatccgcggagagaccaacaccctgccgctt
aacgtcgaactgctgtatcaggactaccaggccgccgccgcctttgccagcgcggtgctg
ctcgtcctcatcgccctcgccaccctcgcgctgaaaacctgggtggcgcggaaggaacac
gcataa

DBGET integrated database retrieval system