Chloracidobacterium sp. MS 40/45: J8C02_11880 Help Entry J8C02_11880       CDS       T07464                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism chlo  Chloracidobacterium sp. MS 40/45 Brite KEGG Orthology (KO) [BR:chlo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:chlo03032]     J8C02_11880    03036 Chromosome and associated proteins [BR:chlo03036]     J8C02_11880    03400 DNA repair and recombination proteins [BR:chlo03400]     J8C02_11880 DNA replication proteins [BR:chlo03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     J8C02_11880 Chromosome and associated proteins [BR:chlo03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     J8C02_11880 DNA repair and recombination proteins [BR:chlo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       J8C02_11880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding 2C_adapt HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QUW01814 LinkDB All DBs Position 2:182215..182487 Genome browser AA seq 90 aa AA seqDB search MTKTEIVNHFAEKFGFPKQKVREFFDEQARLAAAQAKVGFTIPGVGKLVVREYKAREGRN PRTGEKIKIKARKRLKFVISAAAKKAAGFE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccaaaaccgaaattgtcaaccacttcgccgaaaagttcggcttcccgaaacagaag gtgcgtgaatttttcgatgaacaggcccggcttgccgccgcgcaggccaaagtcggcttc acgattccaggggtcgggaaactggtggtccgggaatacaaggcgcgtgaggggcgcaat ccacgcaccggcgaaaagatcaaaatcaaagcccggaaacggctcaagttcgtcatttcc gccgccgccaaaaaagcggccggtttcgagtag

DBGET integrated database retrieval system