Corynebacterium halotolerans: A605_06140 Help Entry A605_06140        CDS       T02472                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism chn  Corynebacterium halotolerans Pathway chn00190   Oxidative phosphorylation chn01100   Metabolic pathways Module chn_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:chn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     A605_06140  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:chn00194]     A605_06140 Photosynthesis proteins [BR:chn00194]  Photosystem and electron transport system   F-type ATPase [OT]    A605_06140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AGF72234 UniProt:  M1MWV7 LinkDB All DBs Position 1332715..1332960 Genome browser AA seq 81 aa AA seqDB search MNEIILAQDAAAAAPNLGAVGYGIATIGPGLGIGILVGKALEGMARQPEMAGQLRTTMFL GIAFVEALALIGLVAGFLFTN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaacgagatcatcctcgcccaggacgctgccgccgccgcccctaacctcggcgctgtc ggctacggcattgccaccatcggcccgggcctcggcatcggcatcctcgtcggcaaggct ctggagggcatggcccgccagcccgagatggccggccagctccgcaccaccatgttcctg ggtatcgccttcgttgaggccctggccctcatcggcctggtcgccggcttcctgttcacc aactaa

DBGET integrated database retrieval system