Cryptosporidium hominis: Chro.70444 Help Entry Chro.70444        CDS       T00210                                  Name (RefSeq) autophagy 8i   KO K08341   GABA(A) receptor-associated protein Organism cho  Cryptosporidium hominis Pathway cho04136   Autophagy - other Brite KEGG Orthology (KO) [BR:cho00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     Chro.70444  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cho04131]     Chro.70444    04121 Ubiquitin system [BR:cho04121]     Chro.70444    03029 Mitochondrial biogenesis [BR:cho03029]     Chro.70444 Membrane trafficking [BR:cho04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     Chro.70444 Ubiquitin system [BR:cho04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    Chro.70444 Mitochondrial biogenesis [BR:cho03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     Chro.70444 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  3414276 NCBI-ProteinID:  XP_668041 LinkDB All DBs Position 7 AA seq 83 aa AA seqDB search MNMLVGEFKYIIHKHITQSSNNQNSGIKIPVPYEKTIYLFVNNTIPKAGSLMQEVYEQYV SDDGFLYVEYSSENAFGGYHSII NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaatatgttggttggagaattcaagtatataattcataagcatattactcaatcttct aataatcaaaatagtggaattaaaatacctgtaccatacgagaagaccatatatttattt gtgaataatacgatacccaaggctgggtcgttaatgcaagaagtatacgagcaatatgtt tctgatgacgggttcctatatgtagaatatagctctgaaaatgcatttggtggatatcat tccattatctag

DBGET integrated database retrieval system