KEGG   Chondrocystis sp. NIES-4102: NIES4102_21900
Entry
NIES4102_21900    CDS       T05085                                 
Name
(GenBank) NADH dehydrogenase (quinone)
  KO
K05579  NAD(P)H-quinone oxidoreductase subunit H [EC:7.1.1.2]
Organism
chon  Chondrocystis sp. NIES-4102
Pathway
chon00190  Oxidative phosphorylation
chon01100  Metabolic pathways
Module
chon_M00145  NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Brite
KEGG Orthology (KO) [BR:chon00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NIES4102_21900
Enzymes [BR:chon01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     NIES4102_21900
SSDB
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Other DBs
NCBI-ProteinID: BAZ45172
LinkDB
Position
complement(2480560..2481744)
AA seq 394 aa
MAQIETRTEPMILNMGPHHPSMHGVLRLIVTLDGEDVIDCEPVIGYLHRGMEKIAESRTS
VMYVPYVSRWDYAAGMFNEAITVNAPEKLAGIEVPKRAQYIRVIMLELNRIANHLLWLGP
FMADVGAQTPFFYIFRERELIYDLWEAATGQRLVNNNYFRIGGVSVDLPYGWIDKCEDFC
DYFDPKVDEYEKLITNNPIFRRRVEGVGTISRDQAINWGLSGPMLRASGVKWDLRKVDHY
ECYDDFDWDVQWETAGDCFARYLVRVREMRESVKIIRQALKAIPGGAYENLEAKRLADGR
KSQWNDFEYQYVAKKVAPTFKIPAGEHYVRLESGKGELGIFIVGNDNVFPWRWKIRAPDF
NNLQILPELLKGVKLADIMPILGSVDIIMGSVDR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggcacagatagaaactagaaccgaacccatgatcctgaacatggggccgcaccatccc
tcaatgcacggcgttttacgtctgattgtaactttagatggggaagatgtaatcgattgc
gaacccgtaattggttatcttcatcgcggaatggaaaaaattgcagaaagtcgcaccagc
gttatgtatgttccttatgtaagtcgttgggactatgctgctggaatgtttaatgaagca
attactgtaaatgcacctgaaaaactggcaggtattgaagtaccaaaacgcgctcagtat
attcgggtgattatgctagagttaaaccgcattgctaatcatttattgtggttagggccg
tttatggcagatgttggagcgcaaactccctttttctacattttccgtgaacgtgagtta
atctacgatctatgggaagctgctactggtcaaagattagttaataataactatttccgt
attggtggtgtctcggtagatttaccctacgggtggattgataaatgtgaagatttttgt
gattattttgatcctaaagtcgatgaatatgaaaaattaattactaataacccaattttc
cgccgtcgtgtagaaggagtaggtactattagtcgtgatcaagcaattaactggggttta
tcagggccgatgttaagagcttctggcgttaaatgggacttgcgtaaagtagaccactat
gaatgttacgatgattttgattgggatgttcagtgggaaacagcaggggattgttttgct
cgctacttagttcgagtccgtgaaatgcgagaatcagttaagattattcgtcaagcacta
aaagctattcctggtggtgcttatgaaaacttagaggcaaaacgcctagcggatggtcgt
aagtcgcagtggaatgactttgaatatcagtatgtagctaaaaaagttgcacctactttt
aaaattcctgcaggagaacattatgttcgtcttgaaagtggcaaaggcgaattagggata
tttattgttggtaatgataatgtctttccttggcgttggaaaattcgcgctcctgacttt
aataatttgcaaatattaccagaattgctcaaaggagtgaaattagctgatattatgccg
attcttggtagtgttgatattattatgggttcagttgatcgttaa

DBGET integrated database retrieval system