Caulobacter henricii: AQ619_07845
Help
Entry
AQ619_07845 CDS
T04110
Symbol
cysW
Name
(GenBank) sulfate/thiosulfate transporter permease subunit
KO
K02047
sulfate/thiosulfate transport system permease protein
Organism
chq
Caulobacter henricii
Pathway
chq00920
Sulfur metabolism
chq02010
ABC transporters
Module
chq_M00616
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:
chq00001
]
09100 Metabolism
09102 Energy metabolism
00920 Sulfur metabolism
AQ619_07845 (cysW)
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
AQ619_07845 (cysW)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
chq02000
]
AQ619_07845 (cysW)
Transporters [BR:
chq02000
]
ABC transporters, prokaryotic type
Mineral and organic ion transporters
Sulfate/thiosulfate transporter
AQ619_07845 (cysW)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
Motif
Other DBs
NCBI-ProteinID:
ALL13271
UniProt:
A0A0P0NZJ8
LinkDB
All DBs
Position
1697032..1697877
Genome browser
AA seq
281 aa
AA seq
DB search
MAAPRLSTEDPAWAKVLIISLVLAFLALVLVLPLVAVFAEALRKGLQPALEAISNPDAIA
AVKLTLLTAAITVPFNVVFGLCAAWAVAKHEFPGKSLLITLIDLPFSVSPVVAGLIYVLV
FGLQGWVGDHLVESDIKIIFAVPGIVLATIFVTFPFVARELIPLMQEQGTSEEEAAVSMG
ASGLYTFWRVTAPNVRWGLLYGVLLCNARAMGEFGAVSVVSGHIRGLTNTMPLHVEILYN
EYDFVGAFSVAALLCLLAILTLVLKTVLEVVQPGASRRGGH
NT seq
846 nt
NT seq
+upstream
nt +downstream
nt
atggctgctccgcgtctttccacagaggatcccgcctgggccaaggtgctgatcatcagc
ctggtcctggccttcctggccctggtgctggtcttgccgctggtcgcggtctttgccgag
gccctgcgcaagggcctccagcccgctcttgaggccatttccaatcctgatgccattgcg
gccgtgaagctcaccctcctgacggcggcgattaccgtgccgttcaatgtggtgttcgga
ctctgcgccgcctgggctgtggccaagcacgagtttccgggcaagagcctgctgatcacc
ctgatcgacctgccgttctcggtctcgccggtcgtggccggcctgatctatgttttggtc
tttggtctgcagggctgggtcggcgaccatttggtcgagagcgacatcaagatcatcttc
gcagtgccgggcatcgtccttgcgacaatcttcgtgaccttcccctttgttgcccgtgaa
ctgatcccgctgatgcaggaacaggggaccagtgaagaggaagcagcggtctcgatggga
gcctcgggcctctacaccttctggcgtgtgacggcgccgaatgtccgctgggggctgctc
tacggcgtcctgctttgcaacgcccgcgccatgggcgagttcggtgccgtgtcggtggtt
agcgggcatatccggggcctgaccaacaccatgcccctgcatgtcgagatcctctacaac
gagtatgatttcgtcggagccttctcagtggctgccttgctatgcctgctggcgatcctg
accctcgtcctcaagaccgtgcttgaagtcgtccagcccggcgcaagccggcgcggcggc
cactga
DBGET
integrated database retrieval system