Caulobacter henricii: AQ619_08185 Help Entry AQ619_08185       CDS       T04110                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chq  Caulobacter henricii Pathway chq01100   Metabolic pathways chq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AQ619_08185    00074 Mycolic acid biosynthesis     AQ619_08185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AQ619_08185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALL13335 UniProt:  A0A0P0NYT8 LinkDB All DBs Position 1765256..1765495 Genome browser AA seq 79 aa AA seqDB search MSDILERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFITEKTGA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacattctcgagcgcgtgcgtaagatcgtcatcgagcatctggatgccgatccc gagaaggtcaccgagaaggccagcttcatcgatgacttgggcgccgacagcctcgacaac gtcgagttggtgatggcgttcgaagaagagttcgacatcgaaattccggacgacgccgct gagcacatccagacggttggcgacgccgtgaagttcatcacggaaaagaccggcgcctaa

DBGET integrated database retrieval system