Caulobacter henricii: AQ619_14170 Help Entry AQ619_14170       CDS       T04110                                  Name (GenBank) hypothetical protein   KO K02651   pilus assembly protein Flp/PilA Organism chq  Caulobacter henricii Pathway chq02020   Two-component system chq04112   Cell cycle - Caulobacter Brite KEGG Orthology (KO) [BR:chq00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AQ619_14170  09140 Cellular Processes   09143 Cell growth and death    04112 Cell cycle - Caulobacter     AQ619_14170  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:chq02044]     AQ619_14170    02035 Bacterial motility proteins [BR:chq02035]     AQ619_14170 Secretion system [BR:chq02044]  Type II secretion system   Tight adherence (Tad) export apparatus    AQ619_14170 Bacterial motility proteins [BR:chq02035]  Pilus system   Pilus assembly proteins    AQ619_14170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Flp_Fap Flp1_like Motif Other DBs NCBI-ProteinID:  ALL14400 UniProt:  A0A0P0P2L7 LinkDB All DBs Position complement(3023374..3023556) Genome browser AA seq 60 aa AA seqDB search MPKFLSRFLNDESGATAIEYGLIVALVAVVIVSAVTTLGTNLKATFTKVGTKVATANAAS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgcccaagttcttgtctcggtttctgaacgacgagtccggcgcgaccgccattgaatac ggcttgatcgttgccctggttgccgtcgtgatcgtgagcgcggtcaccacgttgggcacc aacctgaaggccaccttcaccaaggttggaaccaaggtggccacggccaacgcggccagc tag

DBGET integrated database retrieval system