Chromobacterium phragmitis IIBBL 274-1: DK843_06830 Help Entry DK843_06830       CDS       T05744                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism chrb  Chromobacterium phragmitis IIBBL 274-1 Brite KEGG Orthology (KO) [BR:chrb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:chrb03032]     DK843_06830    03036 Chromosome and associated proteins [BR:chrb03036]     DK843_06830    03400 DNA repair and recombination proteins [BR:chrb03400]     DK843_06830 DNA replication proteins [BR:chrb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DK843_06830 Chromosome and associated proteins [BR:chrb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DK843_06830 DNA repair and recombination proteins [BR:chrb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DK843_06830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AXE34040 UniProt:  A0A344UFJ2 LinkDB All DBs Position 1414430..1414702 Genome browser AA seq 90 aa AA seqDB search MNKQDLIKHLAAHADVTNKQAESVLNALTTAVLDTVRAGGELTISDLGKFGTTQRAAKTG RNPKTGETIQIAAKRAPKFAAAKALKDAAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaagacctgatcaaacacctggccgcccacgcggatgtcaccaacaaacaa gccgaatccgttctcaacgcgctgaccactgcggtgctggataccgtgcgggcgggtggc gagctgacaatttctgaccttggcaagtttggcaccacccagcgcgcagccaagaccggc cgtaatccgaaaaccggtgagaccatccagatcgccgctaagcgcgcgcccaagttcgcc gcggccaaggcgctgaaggacgccgccgcgtaa

DBGET integrated database retrieval system