Chromobacterium phragmitis IIBBL 274-1: DK843_12370 Help Entry DK843_12370       CDS       T05744                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism chrb  Chromobacterium phragmitis IIBBL 274-1 Brite KEGG Orthology (KO) [BR:chrb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chrb03036]     DK843_12370 Chromosome and associated proteins [BR:chrb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DK843_12370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Crescentin RsmF-B_ferredox FliT Cep57_CLD_2 Asd-4 Med21 DUF7620 YabA Motif Other DBs NCBI-ProteinID:  AXE35023 UniProt:  A0A344UIC5 LinkDB All DBs Position complement(2569989..2570198) Genome browser AA seq 69 aa AA seqDB search MDNELEYLESRVAALIGRIRELEVQNGRFAEALSEALKENAELNFRVNETRSRVAALVAR LPAAPENEQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacaatgaactggaatacctcgaatcccgagtcgcggcgctgatcggccgcatccgg gagctggaagtccagaatggccgtttcgccgaagcgctgtccgaagcgctcaaggaaaac gccgagctgaacttccgcgtcaacgaaacccgcagtcgggtggcggccctggtggcgcgc ctgcccgccgcgccggagaatgagcaatga

DBGET integrated database retrieval system