Chromobacterium phragmitis IIBBL 274-1: DK843_21210 Help Entry DK843_21210       CDS       T05744                                  Name (GenBank) (2Fe-2S)-binding protein   KO K10814   hydrogen cyanide synthase HcnA [EC:1.4.99.5] Organism chrb  Chromobacterium phragmitis IIBBL 274-1 Pathway chrb00460   Cyanoamino acid metabolism chrb01100   Metabolic pathways chrb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chrb00001]  09100 Metabolism   09106 Metabolism of other amino acids    00460 Cyanoamino acid metabolism     DK843_21210  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02042 Bacterial toxins [BR:chrb02042]     DK843_21210 Enzymes [BR:chrb01000]  1. Oxidoreductases   1.4  Acting on the CH-NH2 group of donors    1.4.99  With unknown physiological acceptors     1.4.99.5  glycine dehydrogenase (cyanide-forming)      DK843_21210 Bacterial toxins [BR:chrb02042]  Not specified   Hydrogen cyanide production    DK843_21210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer2_4 Fer2_3 DHODB_Fe-S_bind Fer2 Motif Other DBs NCBI-ProteinID:  AXE36586 UniProt:  A0A344UMT8 LinkDB All DBs Position complement(4451859..4452170) Genome browser AA seq 103 aa AA seqDB search MSLHRSHDIQTLQGPTLTIHINDQPVAAASGETVLSVLSAVGLRQVSRNDSKQVAGSYCG MGVCHCCLVKIDGRHKRRACQTVVRPGMKVETASNRIDSEGLR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccttacatcgcagtcacgacatccagacattgcaggggccgaccctgaccatacac atcaacgaccaaccggttgccgccgccagcggcgaaaccgtgctcagcgtgctcagcgcc gtcggcctgcgccaggtgagccgcaatgacagcaagcaggtcgccggctcctattgcggc atgggcgtatgccactgctgcctggtcaagatagacggccgccacaaacgccgcgcctgc cagaccgtggtccgccccggcatgaaggtggaaaccgccagcaaccgcatcgactcggag ggcctgcgatga

DBGET integrated database retrieval system