Chryseoglobus sp. 28M-23: IE160_05560 Help Entry IE160_05560       CDS       T06824                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chre  Chryseoglobus sp. 28M-23 Pathway chre01100   Metabolic pathways chre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IE160_05560    00074 Mycolic acid biosynthesis     IE160_05560   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IE160_05560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QOD94654 LinkDB All DBs Position complement(1139233..1139481) Genome browser AA seq 82 aa AA seqDB search MALSTEEVLAGLAELINDETGISTDSVALDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVTYIVGAQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagttctcgccggcctcgccgagctcatcaatgacgagacc ggaatctcgaccgactcggtcgctctcgacaagtcgttcaccgacgacctcgacatcgac tcgatctcgatgatgacgatcgtcgtgaacgcggaagagaagttcgacgtcaagatcccc gacgaagaggtcaagaacctcaagaccgtcggtgacgccgtcacctacatcgtgggcgcc cagggctga

DBGET integrated database retrieval system