KEGG   Chryseoglobus sp. 28M-23: IE160_06055
Entry
IE160_06055       CDS       T06824                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
chre  Chryseoglobus sp. 28M-23
Pathway
chre02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:chre00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    IE160_06055 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:chre02000]
    IE160_06055 (phnC)
Enzymes [BR:chre01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     IE160_06055 (phnC)
Transporters [BR:chre02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    IE160_06055 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_29 nSTAND1 RsgA_GTPase AAA_22 AAA_33 AAA_16 KdpD AAA_25 MMR_HSR1 NB-ARC
Other DBs
NCBI-ProteinID: QOD94737
LinkDB
Position
1246053..1246901
AA seq 282 aa
MISFRDVTVTYPTGTVGLDGVTLDIAPGEFVVVVGLSGAGKSTLVRSINGLVPVTGGELL
VDNVHVDGAKPAQLRRLRSRIGIIFQSFNLVGRISVLQNVLVGRLHATPLLLSLFGLFRQ
ADKEKAFEALERVGIVEKAYVRASQLSGGQQQRVAIARVLAQDPTVILADEPVASLDPPT
AHMVMRDLERINDELGITTIVNLHFLDLARRYADRIIGMREGRVVFDGPPAEADDAVFEQ
IYGRSLTADDVLSEEEQAEEDALQAQAAADLDVEESRKATPA
NT seq 849 nt   +upstreamnt  +downstreamnt
gtgatctccttccgtgacgtcaccgtcacctatccgaccggcaccgtgggcctcgacggc
gtgactctcgacatcgcgcccggagagttcgtcgtcgtcgtcggtctctccggcgccggg
aagtcgaccctcgtgcggtcgatcaacggcctcgtaccggtgacgggcggcgagctcctc
gtcgacaacgtccacgtggacggtgcgaagcccgcgcagctgcggcgactgcgatcgcgc
atcgggatcatcttccagtcgttcaacctggtcgggcgcatctcggtgctgcagaacgtg
ctcgtgggtcgcctgcacgccacgcccctcctgctctccctcttcgggctcttccggcag
gccgacaaggagaaggcgttcgaggccctcgaacgcgtcggcatcgtcgagaaggcctac
gtgcgcgcgtcccagctctccggcggccagcagcagcgggttgccatcgcccgcgttctc
gcacaggacccgacggtgatcctcgccgacgagcccgtcgcctccctcgatccgccgacg
gcgcacatggtcatgcgcgacctcgagcgcatcaacgacgagctcggcatcacgacgatc
gtcaacctgcacttcctcgatctcgctcgccgctatgcggaccgcatcatcggcatgcgc
gagggtcgagtcgtcttcgacggccctcctgccgaggcggatgacgctgtgttcgagcag
atctacgggcgctcgctcaccgcggacgacgtgctctccgaggaggagcaggcggaggag
gacgccctgcaggctcaggccgcagcggacctcgacgtcgaggagtcacgcaaggcgacg
cccgcgtga

DBGET integrated database retrieval system