Chromobacterium phragmitis IIBBL 112-1: DK842_20055 Help Entry DK842_20055       CDS       T05549                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chri  Chromobacterium phragmitis IIBBL 112-1 Pathway chri01100   Metabolic pathways chri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DK842_20055    00074 Mycolic acid biosynthesis     DK842_20055   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DK842_20055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXE31985 UniProt:  A0A344UDM6 LinkDB All DBs Position complement(4233399..4233662) Genome browser AA seq 87 aa AA seqDB search MMDAVEKQIFPVEARVLAVMAATLGADVESMRPQASLVDELYADSLELLDMVMALNDAFG IEIGADDIAGIRTVGDVCSAVRQRLAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgatggatgccgtggaaaaacagatcttcccggtcgaggcccgcgtgctggccgtgatg gcggcgacgctgggcgccgatgtggagagcatgcgcccgcaggccagcctggtggacgaa ctgtacgccgactcgctggaactgctggacatggtgatggcgctgaacgacgcgttcggc atcgagatcggcgccgacgacatcgccggcatccgcacggtgggcgatgtttgctcggcg gtccggcagcggctggccgcctga

DBGET integrated database retrieval system