Chromobacterium paludis: FYK34_16545
Help
Entry
FYK34_16545 CDS
T06224
Name
(GenBank) hypothetical protein
Organism
chrm
Chromobacterium paludis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
QEL57054
UniProt:
A0A5C1DK77
LinkDB
All DBs
Position
complement(3497662..3499239)
Genome browser
AA seq
525 aa
AA seq
DB search
MSKDLQDYRGQLLARIKSQMLAADFGNAGASDLVMQSALLKAYSFVGNLDALDIDYLLDM
TAADLDNHLQDAANSARFSALLQSTRTVRALAASAPIMAAIAGSAAAMALLAANGPATAA
IADNAQAIGQLALSATAMKVLAGSAIAMSAVAASSTAMSIVSASAIAMTALAASTPAMGA
LAASATAMLLIVSSVTAMSIVVASPTALAALAASATAMGVLGASPVGMSILAASATAMAV
AAASSVAMTALAASSVAMAAIVASAPALSAVLGSTIAMNVLAASAVAMAAVMASTPALSA
ASVSTVAMSALAASLAARSALLGSSTALGIIGGSTMAVGKLAAGIIGLDAQAIADIAAVI
ASPAALTAMAASPAAMTVLVASPSAMTALAASSPAMAVLAASATAINALNASDIAMDALY
ASPLTTKVSYNSAQIWSGVNTLRSGITLFVRLTTKAGGAGWGEGNSTNEWMLFDGAQINF
AERKANPYNHTGLSSAPRLPLRRCASTLQIRVYQACEIAYIALPA
NT seq
1578 nt
NT seq
+upstream
nt +downstream
nt
atgtcaaaagacttgcaagactatcgcggccagctcttggcgcggatcaagagccaaatg
ctggccgccgacttcggcaatgccggcgccagcgatctggtgatgcaatcggcgctgctc
aaggcgtatagctttgtcggcaatctggacgcgctggatatcgattatctgctggacatg
acggcggcggatctggacaaccatttgcaagacgccgccaacagcgcgcgcttcagcgcc
ttattgcagtccacccgcacggtcagggcgctggccgccagcgcgcccatcatggccgcc
atcgccggcagcgccgccgccatggccttgctggccgccaacgggccggccacggcggcg
atcgccgacaatgcgcaggccatcggccagctggcgctcagcgccacggcgatgaaagtc
ttggcgggcagcgcgattgcgatgtcagccgtggcggcgtcttctacggcgatgtctatt
gtttccgcctccgccatcgccatgacggcgctggcggcttcgacgccggcgatgggcgcg
ctggcggcctcggcaacggcgatgcttctcatcgtctcctcggtgacggcgatgtctatc
gtggtggcttctccgacggcccttgcggcgctggccgcctccgctacggcgatgggcgta
ttgggcgcctctcccgtcggcatgtccattctggcggcgtccgccaccgccatggctgtg
gcggcggcctccagcgtggcgatgaccgcgcttgccgcgtcatcggtggcgatggcggca
atcgtggcttccgctccggcattgagtgccgtgctggggtcgaccatcgcgatgaatgta
ttggcggcatccgccgtggcgatggctgcggtgatggcgtccacgccagcgttgagcgcc
gcctcggtttcgaccgtcgcgatgagcgcgttggcagccagtctggctgcgcggtcggcg
ctgctcgggtcgtctacagccttgggcatcattggcggcagcacgatggcggtcggcaag
ctggcggcgggcattatcggattggatgcgcaagccatcgccgacatcgccgcggtgatc
gcgtcgccggccgctctgaccgccatggcggcctctccggcggcgatgactgtgctggtg
gcatccccgtctgcgatgactgcgctggcggcgtcttcgccggcgatggctgtattggcg
gcgtccgctacggcgattaacgccctgaacgcatcggacatcgccatggacgcattgtat
gcgtcgccgctgacgaccaaggtcagctacaactccgcccagatttggagcggcgtcaat
accttgcgttccggcatcacgctgtttgtgcgcttgaccaccaaggcgggcggggcgggc
tggggcgaaggcaatagcaccaatgaatggatgctgtttgacggcgcccagatcaatttc
gcggaacgcaaagcgaacccgtacaaccacaccgggttgtcgtccgcgccgcgtctgccg
ctgcgccgctgcgcttccactttgcaaatccgtgtctaccaggcgtgtgaaatcgcctat
atcgcgctgccggcataa
DBGET
integrated database retrieval system