Chromobacterium sp. ATCC 53434: CXB49_04510 Help Entry CXB49_04510       CDS       T05234                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chro  Chromobacterium sp. ATCC 53434 Pathway chro01100   Metabolic pathways chro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CXB49_04510    00074 Mycolic acid biosynthesis     CXB49_04510   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CXB49_04510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  AUH50133 LinkDB All DBs Position 962801..963040 Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNEAEIKIESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAVDYVTANLNK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaaacatcgaacagcgcgtcaagaagatcgttgccgaacaactgggcgtgaacgaa gccgagatcaagatcgaaagctctttcgttgacgatctgggcgcggactccctggatacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgaaattccggacgaagaggcc gagaagatcacgaccgttcagcaagccgtcgactacgtcactgccaacctgaacaagtaa

DBGET integrated database retrieval system