Chromobacterium sp. ATCC 53434: CXB49_08785 Help Entry CXB49_08785       CDS       T05234                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chro  Chromobacterium sp. ATCC 53434 Pathway chro01100   Metabolic pathways chro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CXB49_08785    00074 Mycolic acid biosynthesis     CXB49_08785   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CXB49_08785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUH50899 UniProt:  A0A2H5DV20 LinkDB All DBs Position complement(1949603..1949863) Genome browser AA seq 86 aa AA seqDB search MQNLELEIKTLLIDALNLEDITADDIASDAALFGEGLGLDSIDALELGLALQKRYGVTLS PDAEETRRHFASIAALASFVATARKL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaaaacctggaacttgagatcaagacgctcttgatcgacgcgctgaacctcgaagac atcaccgccgacgatatcgcaagcgacgcggcgctattcggggaaggcctcgggctggac tccatcgatgcgctggagctgggcctcgccctgcagaaacgctacggcgtgacgctgtct ccggacgccgaggaaacccggcgccacttcgccagcatcgccgcgctggcgagcttcgtc gccaccgcccgcaagctgtaa

DBGET integrated database retrieval system