Chromobacterium sp. ATCC 53434: CXB49_17910 Help Entry CXB49_17910       CDS       T05234                                  Name (GenBank) ATPase   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism chro  Chromobacterium sp. ATCC 53434 Pathway chro03430   Mismatch repair Brite KEGG Orthology (KO) [BR:chro00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     CXB49_17910  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:chro03400]     CXB49_17910 Enzymes [BR:chro01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      CXB49_17910 DNA repair and recombination proteins [BR:chro03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      CXB49_17910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF3348 Med30 Motif Other DBs NCBI-ProteinID:  AUH52535 UniProt:  A0A2H5DZR7 LinkDB All DBs Position complement(4060625..4060834) Genome browser AA seq 69 aa AA seqDB search MTDTASFAESYAILEQTAEALQEMTEADIDQLVPLVERGLAAHRVCEERIKQVRAMLEEK LGMQPGTGE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccgatacggcaagctttgctgaaagctacgccattcttgagcagacagccgaagca ctacaagaaatgactgaagctgacattgatcagctggttcccttggttgaaaggggtttg gccgcacatcgtgtttgtgaagaacgtatcaaacaggttcgggccatgcttgaagagaag ctagggatgcagcctgggactggagagtag

DBGET integrated database retrieval system