Chromobacterium sp. ATCC 53434: CXB49_22280 Help Entry CXB49_22280       CDS       T05234                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism chro  Chromobacterium sp. ATCC 53434 Brite KEGG Orthology (KO) [BR:chro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chro03036]     CXB49_22280 Chromosome and associated proteins [BR:chro03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CXB49_22280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB RsmF-B_ferredox Rod_CreS Cep57_CLD_2 CENPH Med21 YabA Knl1_RWD_C Motif Other DBs NCBI-ProteinID:  AUH53311 LinkDB All DBs Position 4972142..4972351 Genome browser AA seq 69 aa AA seqDB search MDNELEYLESRVAALIVRIRELETQNGRFAEALSEALKENAELNFRVNETRSRVAALVAR LPAPPEDEQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacaatgaactggaatacctcgaatcccgcgtcgcggcgctgatcgtccgcatccgg gaactggaaacccagaacggccgcttcgccgaggcgctgtccgaagcgctgaaggaaaac gccgaactgaatttccgcgtcaacgaaacccgcagccgggtggcggccctggtcgcgcgt ctgccggcgccgccggaggatgagcaatga

DBGET integrated database retrieval system