Chryseobacterium sp. POL2: G6R40_08105 Help Entry G6R40_08105       CDS       T11017                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism chrp  Chryseobacterium sp. POL2 Brite KEGG Orthology (KO) [BR:chrp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:chrp03032]     G6R40_08105    03036 Chromosome and associated proteins [BR:chrp03036]     G6R40_08105    03400 DNA repair and recombination proteins [BR:chrp03400]     G6R40_08105 DNA replication proteins [BR:chrp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G6R40_08105 Chromosome and associated proteins [BR:chrp03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G6R40_08105 DNA repair and recombination proteins [BR:chrp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G6R40_08105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QIG89631 UniProt:  A0A6G6YHL8 LinkDB All DBs Position 1749820..1750110 Genome browser AA seq 96 aa AA seqDB search MNKSELIDAIAKDAEITKVAAKKALESFISNVTTTLKKKEGKVSLVGFGTFSVSERAARQ GINPATKKPIKIAAKKVAKFKAGADLATAVAGAKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtctgaattaatcgatgcaatcgcgaaagatgcagaaatcacaaaagtagct gctaagaaagctttagaatcatttattagcaatgttacaacaactttgaaaaagaaagaa ggtaaagtatctctagtaggattcgggactttctcggtatcggaaagagctgcaagacaa ggtatcaaccctgcaacaaaaaagccaatcaaaattgctgctaaaaaagtggcaaaattc aaagctggagctgacttagctactgcagtagctggcgcaaagaaaaaataa

DBGET integrated database retrieval system