Chryseobacterium sp. PMSZPI: ACL0VS_14915 Help Entry ACL0VS_14915      CDS       T11402                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chrr  Chryseobacterium sp. PMSZPI Pathway chrr01100   Metabolic pathways chrr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chrr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACL0VS_14915    00074 Mycolic acid biosynthesis     ACL0VS_14915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACL0VS_14915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  XNN37210 LinkDB All DBs Position 3413795..3414043 Genome browser AA seq 82 aa AA seqDB search MQNQEKLFEKVYEILGDITECDPKNIQPDTNLLHDMGMTSLMGLEVLVELERNFQVSLDE ELLANMTTPKDIVKILENELAY NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcaagaaaaattatttgaaaaagtatacgagattctaggagatattacagaa tgtgatcctaaaaatatacagccagatactaatcttttgcacgatatgggtatgacatct ctaatgggactggaagtattagtagaattggaaaggaattttcaggttagtctggatgaa gaacttctagctaatatgactactccaaaagatattgttaaaattctggagaatgaatta gcttattaa

DBGET integrated database retrieval system