Capra hircus (goat): 100860751 Help Entry 100860751         CDS       T02910                                  Symbol CDK2 Name (RefSeq) cyclin-dependent kinase 2   KO K02206   cyclin-dependent kinase 2 [EC:2.7.11.22] Organism chx  Capra hircus (goat) Pathway chx04068   FoxO signaling pathway chx04110   Cell cycle chx04114   Oocyte meiosis chx04115   p53 signaling pathway chx04151   PI3K-Akt signaling pathway chx04218   Cellular senescence chx04914   Progesterone-mediated oocyte maturation chx04934   Cushing syndrome chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05165   Human papillomavirus infection chx05166   Human T-cell leukemia virus 1 infection chx05169   Epstein-Barr virus infection chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05215   Prostate cancer chx05222   Small cell lung cancer chx05226   Gastric cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100860751 (CDK2)    04151 PI3K-Akt signaling pathway     100860751 (CDK2)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100860751 (CDK2)    04114 Oocyte meiosis     100860751 (CDK2)    04115 p53 signaling pathway     100860751 (CDK2)    04218 Cellular senescence     100860751 (CDK2)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     100860751 (CDK2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100860751 (CDK2)    05203 Viral carcinogenesis     100860751 (CDK2)   09162 Cancer: specific types    05226 Gastric cancer     100860751 (CDK2)    05215 Prostate cancer     100860751 (CDK2)    05222 Small cell lung cancer     100860751 (CDK2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100860751 (CDK2)    05161 Hepatitis B     100860751 (CDK2)    05160 Hepatitis C     100860751 (CDK2)    05162 Measles     100860751 (CDK2)    05169 Epstein-Barr virus infection     100860751 (CDK2)    05165 Human papillomavirus infection     100860751 (CDK2)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100860751 (CDK2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:chx01001]     100860751 (CDK2)   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:chx03032]     100860751 (CDK2)    03036 Chromosome and associated proteins [BR:chx03036]     100860751 (CDK2) Enzymes [BR:chx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100860751 (CDK2) Protein kinases [BR:chx01001]  Serine/threonine kinases: CMGC group   CDK family    100860751 (CDK2) DNA replication proteins [BR:chx03032]  Eukaryotic type   DNA Replication Initiation Factors    CDK (cyclin dependent kinase)     100860751 (CDK2) Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Centrosome formation proteins    Kinases and associated factors     100860751 (CDK2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase APH Motif Other DBs NCBI-GeneID:  100860751 NCBI-ProteinID:  NP_001272537 UniProt:  A0MSV8 LinkDB All DBs Position 5:complement(56713351..56718920) Genome browser AA seq 298 aa AA seqDB search MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS HRVLHRDLKPQNLLINADGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL NT seq 897 nt NT seq  +upstreamnt  +downstreamnt atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa gccaaaaacaagttgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag acagagggtgtacccagtactgccatacgagagatctctctgcttaaggagcttaatcac cctaatattgtcaagctgctggatgtcattcacacagaaaacaagctctaccttgttttt gagtttctgcaccaggatctcaagaaattcatggatgcctctgcactcactggcattcct cttccgctcataaagagctacttgttccagctgctccagggcctagctttctgccactct catcgggtcctgcaccgagaccttaaacctcagaatctgcttatcaacgcagatgggtcc atcaagctagcagacttcggactagccagagcttttggggtccctgttcgtacttatacc cacgaggtggtgactctgtggtaccgagcaccggaaatccttctgggctgcaaatactac tccacagcagtggacatatggagcctcggttgcatctttgctgagatggtgacccgccgg gccctattccccggagattctgagatcgaccaactcttccggatctttcggaccctggga accccagatgaggtggtttggccaggagttacttctatgcctgattataagccaagtttc cccaagtgggccaggcaggattttagcaaagtggtgcctcccctggatgaagatggacgg agcttgttatcgcaaatgctgcactacgaccctaacaagcggatttcagccaaggcagct ttggctcaccccttcttccaagatgtgaccaagccagtacctcaccttcgactctga

DBGET integrated database retrieval system