Capra hircus (goat): 100860840
Help
Entry
100860840 CDS
T02910
Symbol
PSMA6
Name
(RefSeq) proteasome subunit alpha type-6
KO
K02730
20S proteasome subunit alpha 1 [EC:
3.4.25.1
]
Organism
chx
Capra hircus (goat)
Pathway
chx03050
Proteasome
chx05010
Alzheimer disease
chx05012
Parkinson disease
chx05014
Amyotrophic lateral sclerosis
chx05016
Huntington disease
chx05017
Spinocerebellar ataxia
chx05020
Prion disease
chx05022
Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:
chx00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
100860840 (PSMA6)
09160 Human Diseases
09164 Neurodegenerative disease
05010 Alzheimer disease
100860840 (PSMA6)
05012 Parkinson disease
100860840 (PSMA6)
05014 Amyotrophic lateral sclerosis
100860840 (PSMA6)
05016 Huntington disease
100860840 (PSMA6)
05017 Spinocerebellar ataxia
100860840 (PSMA6)
05020 Prion disease
100860840 (PSMA6)
05022 Pathways of neurodegeneration - multiple diseases
100860840 (PSMA6)
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
chx01002
]
100860840 (PSMA6)
09182 Protein families: genetic information processing
03051 Proteasome [BR:
chx03051
]
100860840 (PSMA6)
Enzymes [BR:
chx01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.25 Threonine endopeptidases
3.4.25.1 proteasome endopeptidase complex
100860840 (PSMA6)
Peptidases and inhibitors [BR:
chx01002
]
Threonine peptidases
Family T1: proteasome family
100860840 (PSMA6)
Proteasome [BR:
chx03051
]
Eukaryotic proteasome
Core particles (20S proteasome)
alpha type subunits
100860840 (PSMA6)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proteasome
Proteasome_A_N
AMIN-like
Ribophorin_II
Motif
Other DBs
NCBI-GeneID:
100860840
NCBI-ProteinID:
NP_001272627
UniProt:
B9VR86
LinkDB
All DBs
Position
21:44964226..44984978
Genome browser
AA seq
246 aa
AA seq
DB search
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
NT seq
741 nt
NT seq
+upstream
nt +downstream
nt
atgtcccgaggttccagcgcgggttttgaccggcacattaccattttttctcccgaggga
cggctctaccaagtagaatatgcttttaaggctattaaccagggtggccttacatcagta
gctgtcagagggaaagactgtgcagtgattgtcacacagaagaaagtacctgacaaatta
ctggattccagcacagtgactcacttattcaagataactgaaaacattggctgtgtgatg
acaggaatgacagctgacagtagatcccaggtacagagggcacgctatgaggcagctaat
tggaaatacaagtatggttacgaaattcccgtggacatgctgtgtaaaagaatcgctgat
atttctcaggtctacacacagaatgctgaaatgaggcctcttggttgttgtatgatttta
attggtatagatgaagagcaaggccctcaggtgtacaagtgtgatcctgcaggttactac
tgtgggtttaaagcaactgcagcaggagttaaacaaactgagtcaaccagcttccttgaa
aaaaaagtaaagaagaaatttgactggacctttgaacagacagtggaaactgcgattaca
tgcctgtctactgttctatcaattgatttcaaaccttcagaaatagaagttggagtagtt
acagtcgaaaatcctaaattcaggattcttacagaagcagagattgacgctcaccttgtt
gctctagcagagagagactag
DBGET
integrated database retrieval system