Capra hircus (goat): 100861189 Help Entry 100861189         CDS       T02910                                  Symbol GHRL Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism chx  Capra hircus (goat) Pathway chx04024   cAMP signaling pathway chx04080   Neuroactive ligand-receptor interaction chx04081   Hormone signaling chx04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     100861189 (GHRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100861189 (GHRL)    04081 Hormone signaling     100861189 (GHRL)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     100861189 (GHRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     100861189 (GHRL) Cytokines and neuropeptides [BR:chx04052]  Neuropeptides   GPCR binding    100861189 (GHRL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  100861189 NCBI-ProteinID:  XP_017893717 UniProt:  Q6BEG7 LinkDB All DBs Position 22:complement(54310409..54314491) Genome browser AA seq 116 aa AA seqDB search MPAPRTICSLLLLSMLWMDLAMAGSSFLSPEHQKLQRKEPKKPSGRLKPRALEGQFDPDV GSQEEGAEDELEIRFNAPFNIGIKLSGAQSLQHGQTLGKFLQDILWEEAEETLADE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcccgccccgcggaccatctgcagcctgctgctgctcagcatgctctggatggacttg gccatggcgggctccagctttctgagccccgaacatcagaaactgcagagaaaggaacct aagaagccgtcaggcagactgaagccccgggccctggaaggccagtttgacccggatgtg ggaagtcaggaggaaggtgcagaggacgagctggaaatccggttcaacgccccctttaac attgggatcaagctgtcaggggctcagtccctccagcatggccagacgctggggaagttt cttcaggacatcctttgggaagaagccgaagaaaccctggctgacgagtga

DBGET integrated database retrieval system