Capra hircus (goat): 100861196 Help Entry 100861196         CDS       T02910                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism chx  Capra hircus (goat) Pathway chx04146   Peroxisome chx04213   Longevity regulating pathway - multiple species chx05012   Parkinson disease chx05014   Amyotrophic lateral sclerosis chx05016   Huntington disease chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:chx00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     100861196 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100861196 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     100861196 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     100861196 (SOD1)    05014 Amyotrophic lateral sclerosis     100861196 (SOD1)    05016 Huntington disease     100861196 (SOD1)    05020 Prion disease     100861196 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     100861196 (SOD1) Enzymes [BR:chx01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      100861196 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  100861196 NCBI-ProteinID:  NP_001272479 EnsemblRapid:  ENSCHIG00000014496 UniProt:  Q5FB29 LinkDB All DBs Position 1:complement(2298761..2307035) Genome browser AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVQGTIHFEAKGDKVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVKADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHE KPDDLGRGGNEESTKTGNAGSCLACGVIGIAP NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtctgcgtgctgaagggtgacggcccggtgcaaggcaccatccac ttcgaggcaaagggagataaagtcgtcgtaactggatccattacagggttgactgaaggt gatcatggattccacgtccatcagtttggagacaatacacaaggctgtaccagtgcaggc cctcactttaatcctctgtccaaaaaacacggtgggccaaaggatgaagagaggcatgtt ggagacctgggcaatgtgaaggctgacaaaaacggtgttgccattgtggatatcgtagat cccttgatctcactctcaggagaatattccatcattggccgcacgatggtggtccatgaa aaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagactgggaacgctgga agctgtttggcctgtggtgtaattggaattgccccgtaa

DBGET integrated database retrieval system