KEGG   Capra hircus (goat): 102168606
Entry
102168606         CDS       T02910                                 
Symbol
ATP5G2
Name
(RefSeq) ATP synthase F(0) complex subunit C2, mitochondrial
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
chx  Capra hircus (goat)
Pathway
chx00190  Oxidative phosphorylation
chx01100  Metabolic pathways
chx04714  Thermogenesis
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05208  Chemical carcinogenesis - reactive oxygen species
chx05415  Diabetic cardiomyopathy
Module
chx_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102168606 (ATP5G2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102168606 (ATP5G2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    102168606 (ATP5G2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102168606 (ATP5G2)
   05012 Parkinson disease
    102168606 (ATP5G2)
   05014 Amyotrophic lateral sclerosis
    102168606 (ATP5G2)
   05016 Huntington disease
    102168606 (ATP5G2)
   05020 Prion disease
    102168606 (ATP5G2)
   05022 Pathways of neurodegeneration - multiple diseases
    102168606 (ATP5G2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    102168606 (ATP5G2)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 102168606
NCBI-ProteinID: XP_005679927
UniProt: A0A452E3G9
LinkDB
Position
5:26112613..26120763
AA seq 143 aa
MYTCAKFVSTPSLIRRTSTLLSRSLSAVVVRRPETLTDESHSSLAVVPRPLTTSLTPSRS
FQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAIL
GFALSEAMGLFCLMVAFLILFAM
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtacacttgcgccaagttcgtctccaccccctccttgatcaggagaacctctacacta
ttgagccgatcactgtctgcagtggtggtaagacgaccggagacactgacagatgagagc
cacagcagcttggcagtagtcccccgtcccctgaccacctcactgactcctagccgcagt
ttccaaacgagtgccatttcaagggacattgacacagcagccaagttcattggagctggg
gctgccacagtaggggtggctggctctggagctggaattgggaccgtgtttgggagtctc
atcattggttatgccaggaacccttctctgaagcagcagctcttctcctacgccattctg
ggctttgccctctcggaggccatggggctcttttgcctgatggtggcctttctcatcctc
ttcgccatgtga

DBGET integrated database retrieval system