Capra hircus (goat): 102169137 Help Entry 102169137         CDS       T02910                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism chx  Capra hircus (goat) Pathway chx04024   cAMP signaling pathway chx04062   Chemokine signaling pathway chx04064   NF-kappa B signaling pathway chx04210   Apoptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04625   C-type lectin receptor signaling pathway chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04662   B cell receptor signaling pathway chx04668   TNF signaling pathway chx04722   Neurotrophin signaling pathway chx04920   Adipocytokine signaling pathway chx04926   Relaxin signaling pathway chx04931   Insulin resistance chx04936   Alcoholic liver disease chx05132   Salmonella infection chx05134   Legionellosis chx05135   Yersinia infection chx05140   Leishmaniasis chx05142   Chagas disease chx05145   Toxoplasmosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05208   Chemical carcinogenesis - reactive oxygen species chx05215   Prostate cancer chx05220   Chronic myeloid leukemia chx05222   Small cell lung cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102169137 (NFKBIA)    04668 TNF signaling pathway     102169137 (NFKBIA)    04024 cAMP signaling pathway     102169137 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102169137 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102169137 (NFKBIA)    04621 NOD-like receptor signaling pathway     102169137 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     102169137 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     102169137 (NFKBIA)    04625 C-type lectin receptor signaling pathway     102169137 (NFKBIA)    04660 T cell receptor signaling pathway     102169137 (NFKBIA)    04658 Th1 and Th2 cell differentiation     102169137 (NFKBIA)    04659 Th17 cell differentiation     102169137 (NFKBIA)    04657 IL-17 signaling pathway     102169137 (NFKBIA)    04662 B cell receptor signaling pathway     102169137 (NFKBIA)    04062 Chemokine signaling pathway     102169137 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102169137 (NFKBIA)    04926 Relaxin signaling pathway     102169137 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102169137 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     102169137 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102169137 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     102169137 (NFKBIA)    05203 Viral carcinogenesis     102169137 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102169137 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     102169137 (NFKBIA)    05215 Prostate cancer     102169137 (NFKBIA)    05222 Small cell lung cancer     102169137 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102169137 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     102169137 (NFKBIA)    05161 Hepatitis B     102169137 (NFKBIA)    05160 Hepatitis C     102169137 (NFKBIA)    05171 Coronavirus disease - COVID-19     102169137 (NFKBIA)    05164 Influenza A     102169137 (NFKBIA)    05162 Measles     102169137 (NFKBIA)    05168 Herpes simplex virus 1 infection     102169137 (NFKBIA)    05163 Human cytomegalovirus infection     102169137 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     102169137 (NFKBIA)    05169 Epstein-Barr virus infection     102169137 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102169137 (NFKBIA)    05135 Yersinia infection     102169137 (NFKBIA)    05134 Legionellosis     102169137 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102169137 (NFKBIA)    05140 Leishmaniasis     102169137 (NFKBIA)    05142 Chagas disease     102169137 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102169137 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102169137 (NFKBIA)    04931 Insulin resistance     102169137 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:chx03000]     102169137 (NFKBIA)    04131 Membrane trafficking [BR:chx04131]     102169137 (NFKBIA) Transcription factors [BR:chx03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     102169137 (NFKBIA) Membrane trafficking [BR:chx04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102169137 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  102169137 NCBI-ProteinID:  XP_017921998 UniProt:  A0A452E2Q3 LinkDB All DBs Position 21:complement(45051338..45054839) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQQLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLSQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagaggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcgctcaccatggaagtggtccgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccggggaacccagcagctccactccattctgcaagccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctgttgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccataccagctcacgtggggccgc cccagcacccggatacagcagcagctgagccagctgaccctagagaaccttcagacactg ccagagagcgaggatgaggagagctatgacaccgaatcagagttcacagaggacgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system