KEGG   Capra hircus (goat): 102169405
Entry
102169405         CDS       T02910                                 
Symbol
PSMD9
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 9 isoform X1
  KO
K06693  26S proteasome regulatory subunit N4
Organism
chx  Capra hircus (goat)
Pathway
chx03050  Proteasome
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    102169405 (PSMD9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102169405 (PSMD9)
   05012 Parkinson disease
    102169405 (PSMD9)
   05014 Amyotrophic lateral sclerosis
    102169405 (PSMD9)
   05016 Huntington disease
    102169405 (PSMD9)
   05017 Spinocerebellar ataxia
    102169405 (PSMD9)
   05020 Prion disease
    102169405 (PSMD9)
   05022 Pathways of neurodegeneration - multiple diseases
    102169405 (PSMD9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:chx03051]
    102169405 (PSMD9)
Proteasome [BR:chx03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     102169405 (PSMD9)
SSDB
Motif
Pfam: Nas2_N PDZ_6 PDZ_2 PDZ GRASP55_65
Other DBs
NCBI-GeneID: 102169405
NCBI-ProteinID: XP_005691460
UniProt: A0A452FD51
LinkDB
Position
17:17791923..17808786
AA seq 221 aa
MSEKAGSQSGGSSEASGVTVSDIQELIRRKEEIEAQIKANYEVLESQKGIGMNEPLVDCE
GYPRADVDLYQVRTARHNIVCLQNDHKAVMKQVEDALHQLHARDKEKQARDLAEAHREAL
SRDESQGLSPAQAFAKVNSVSPGSPASIAGLQVDDEILEFGSVNTQNFQSLQNIGSVVQH
SEGKPLNVTVMRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtcggagaaggcggggagtcagagtgggggctcctcggaggccagtggtgtaactgtc
agcgacattcaggaactgatacggcgcaaggaggagatcgaggcccagatcaaagccaat
tatgaagtgctggagagccaaaaaggcatcgggatgaacgagccactggtggactgcgag
ggctacccccgggcagatgtggacctgtaccaagtccgaactgcaaggcacaacattgtc
tgcctgcagaatgaccacaaggcggtgatgaagcaggtggaagacgccctacaccagctg
catgctcgcgacaaggagaagcaggcccgggacctggccgaagcccatagggaggccctg
agccgcgacgagagccagggcctcagtcctgcccaggccttcgccaaagtgaacagtgtc
agccccggctcccccgccagcatcgcaggtctgcaagtggatgatgagattctggagttt
ggctctgtgaacacccagaacttccagtcactgcagaacattggcagtgtggtccagcac
agtgaggggaagcccctgaatgtgacagtgatgcgcagaggggagaaacaccagcttaga
ctcgtgccaacacgctgggcgggaaaaggactgctgggctgcaacattattccattgcaa
agatga

DBGET integrated database retrieval system