Capra hircus (goat): 102169981 Help Entry 102169981         CDS       T02910                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism chx  Capra hircus (goat) Pathway chx04613   Neutrophil extracellular trap formation chx05034   Alcoholism chx05202   Transcriptional misregulation in cancer chx05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102169981  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102169981   09163 Immune disease    05322 Systemic lupus erythematosus     102169981   09165 Substance dependence    05034 Alcoholism     102169981  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     102169981   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102169981 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102169981 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102169981 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  102169981 NCBI-ProteinID:  XP_005690604 UniProt:  A0A452EAA2 LinkDB All DBs Position 16:29220661..29225425 Genome browser AA seq 136 aa AA seqDB search MARTKRTVYKSTGGKVPRKQLVSEAAGKSAPSTSGMTRPHRYRPGTVALREVRPYQKSTH LLIRKLPFQRLVREIAQDFKTDLKFQSAAIRTLQEASEAYLVVFLESKQHSNLARMYSQN KSFPWLVGKRRQPQPM NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccggaccaagaggacagtttataagtccacgggtgggaaagtgccccgcaaacag ctggtcagtgaagcggccgggaaaagcgccccctctaccagcgggatgacaagacctcat cgctacaggcccgggaccgttgccctccgagaagtccgtccttaccagaagtccacccat cttctgattcggaagctgcctttccagagactggtgagggagatcgcccaggatttcaaa accgacttgaagttccagagtgcagccatccgtacgctgcaggaggctagcgaagcgtac ctggttgtattccttgagtccaagcagcacagtaatctggcaagaatgtactcccagaat aagagcttcccatggcttgtaggaaaaaggagacagccacaacccatgtaa

DBGET integrated database retrieval system