Capra hircus (goat): 102170466 Help Entry 102170466         CDS       T02910                                  Symbol SST Name (RefSeq) somatostatin precursor   KO K05237   somatostatin Organism chx  Capra hircus (goat) Pathway chx04024   cAMP signaling pathway chx04080   Neuroactive ligand-receptor interaction chx04081   Hormone signaling chx04935   Growth hormone synthesis, secretion and action chx04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102170466 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102170466 (SST)    04081 Hormone signaling     102170466 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102170466 (SST)   09154 Digestive system    04971 Gastric acid secretion     102170466 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102170466 (SST) Cytokines and neuropeptides [BR:chx04052]  Neuropeptides   GPCR binding    102170466 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  102170466 NCBI-ProteinID:  NP_001274484 UniProt:  E2DI30 LinkDB All DBs Position 1:79362883..79364074 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctcttggc ggtgtcaccggcgcgccctcggatccccgactccgtcagtttctgcagaaatccctggct gctgccgctggcaaacaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaacgatgccctggagcctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system