Capra hircus (goat): 102170746 Help Entry 102170746         CDS       T02910                                  Name (RefSeq) profilin-2   KO K05759   profilin Organism chx  Capra hircus (goat) Pathway chx04015   Rap1 signaling pathway chx04810   Regulation of actin cytoskeleton chx05014   Amyotrophic lateral sclerosis chx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102170746  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102170746  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102170746   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102170746  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102170746   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:chx04812]     102170746    04147 Exosome [BR:chx04147]     102170746 Membrane trafficking [BR:chx04131]  Others   Actin-binding proteins    Others     102170746 Cytoskeleton proteins [BR:chx04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102170746 Exosome [BR:chx04147]  Exosomal proteins   Proteins found in most exosomes    102170746 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102170746 NCBI-ProteinID:  XP_005697116 LinkDB All DBs Position 24:complement(35354660..35356795) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCHGCCQEAATVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgccatggctgctgccaggaggcc gccactgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggtgcaaagaagtgctcagtgatcagagatagcctatacgtg gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system