Capra hircus (goat): 102171251 Help Entry 102171251         CDS       T02910                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism chx  Capra hircus (goat) Pathway chx04015   Rap1 signaling pathway chx04810   Regulation of actin cytoskeleton chx05014   Amyotrophic lateral sclerosis chx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102171251 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102171251 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102171251 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102171251 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102171251 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:chx04812]     102171251 (PFN4)    04147 Exosome [BR:chx04147]     102171251 (PFN4) Membrane trafficking [BR:chx04131]  Others   Actin-binding proteins    Others     102171251 (PFN4) Cytoskeleton proteins [BR:chx04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102171251 (PFN4) Exosome [BR:chx04147]  Exosomal proteins   Proteins found in most exosomes    102171251 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102171251 NCBI-ProteinID:  XP_013823288 UniProt:  A0A452G6P6 LinkDB All DBs Position 11:74669150..74674491 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFNVMPSDVRTLVNGFAKNPLKTR REGLYFKEKDYKCIRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcggagcctatgtgtagcatcaccaggatttaatgta atgcccagtgatgtccgaacacttgtaaatgggtttgccaaaaaccctttgaaaaccaga agagaaggattgtatttcaaggagaaggactacaaatgtatccgggcagatgactattct ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg gtggcaacttactctgaaggcatgtatcctagtgtctgtgtggaagccacagagaagttg ggagactatctaagaagaaaagggaattaa

DBGET integrated database retrieval system