Capra hircus (goat): 102171272 Help Entry 102171272         CDS       T02910                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04061   Viral protein interaction with cytokine and cytokine receptor chx04062   Chemokine signaling pathway chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04668   TNF signaling pathway chx05020   Prion disease chx05142   Chagas disease chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05168   Herpes simplex virus 1 infection chx05323   Rheumatoid arthritis chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102171272 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102171272 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     102171272 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102171272 (CCL5)    04621 NOD-like receptor signaling pathway     102171272 (CCL5)    04623 Cytosolic DNA-sensing pathway     102171272 (CCL5)    04062 Chemokine signaling pathway     102171272 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102171272 (CCL5)    05168 Herpes simplex virus 1 infection     102171272 (CCL5)    05163 Human cytomegalovirus infection     102171272 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     102171272 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     102171272 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     102171272 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102171272 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102171272 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:chx00536]     102171272 (CCL5) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Chemokines    102171272 (CCL5) Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Chemokines    102171272 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102171272 NCBI-ProteinID:  XP_005693258 UniProt:  A0A452EWQ1 LinkDB All DBs Position 19:14157361..14164201 Genome browser AA seq 91 aa AA seqDB search MKVSSAALAVLLMAAALCAPASASPYASDTTPCCFAYLSRPLPRTHVQEYFYTSSKCSMA AVVFITRKNRQVCANPEKKWVREYINSLELS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctcttccgctgccctcgctgtcctcctgatggcggccgccctctgcgctcct gcgtctgcctccccatatgcctcggacaccaccccctgctgttttgcctacctctcccgc ccgctgccccgcacccacgtccaggaatatttctacaccagcagcaagtgctccatggca gcagttgtctttatcaccaggaagaaccgtcaggtgtgcgccaacccagagaagaagtgg gtgcgagagtacatcaacagtttggagttgagctag

DBGET integrated database retrieval system