Capra hircus (goat): 102171403 Help Entry 102171403         CDS       T02910                                  Symbol FGF20 Name (RefSeq) fibroblast growth factor 20   KO K04358   fibroblast growth factor Organism chx  Capra hircus (goat) Pathway chx04010   MAPK signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04020   Calcium signaling pathway chx04151   PI3K-Akt signaling pathway chx04810   Regulation of actin cytoskeleton chx05200   Pathways in cancer chx05207   Chemical carcinogenesis - receptor activation chx05218   Melanoma chx05224   Breast cancer chx05226   Gastric cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102171403 (FGF20)    04014 Ras signaling pathway     102171403 (FGF20)    04015 Rap1 signaling pathway     102171403 (FGF20)    04020 Calcium signaling pathway     102171403 (FGF20)    04151 PI3K-Akt signaling pathway     102171403 (FGF20)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102171403 (FGF20)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102171403 (FGF20)    05207 Chemical carcinogenesis - receptor activation     102171403 (FGF20)   09162 Cancer: specific types    05226 Gastric cancer     102171403 (FGF20)    05218 Melanoma     102171403 (FGF20)    05224 Breast cancer     102171403 (FGF20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102171403 (FGF20)    00536 Glycosaminoglycan binding proteins [BR:chx00536]     102171403 (FGF20) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Growth factors (RTK binding)    102171403 (FGF20) Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Growth factors/receptors    102171403 (FGF20) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  102171403 NCBI-ProteinID:  XP_005698909 UniProt:  A0A452EP49 LinkDB All DBs Position 27:complement(25329577..25339636) Genome browser AA seq 211 aa AA seqDB search MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAAERGARGGPGAAELAHL HGFLRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR SKRHQKFTHFLPRPVDPERVPELYKDLLMYS NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggctcccttagccgaagtcgggggcttcctgggcggcctagagggcctgggccagcag gtgggctcgcacttcctgctgcctcctgccggggagcggccgcctttgctgggcgagcgc cggggggcggcggagcgaggcgcccgcgggggccctggggcagcggagctggcgcacctg cacggcttcctgcgccgccggcagctctactgccgcaccggcttccacctgcagatcctg cccgacggcagcgtgcagggcacccggcaggaccacagcctcttcggtatcctggaattc atcagtgtggcagtgggacttgtcagtattagaggtgtggacagtggtctttaccttgga atgaatgacaaaggagaactatatggatcagagaaactgacttctgaatgcatctttaga gagcaattcgaagagaactggtataatacctattcatcgaacatatataaacatggagac actggccgcaggtattttgtggcacttaacaaagatggaactccaagagacggtgccagg tccaaaaggcaccagaaatttacacatttcctgcctagaccagtggatccagaaagagtt cctgaactgtacaaggacctacttatgtacagttga

DBGET integrated database retrieval system