KEGG   Capra hircus (goat): 102172257
Entry
102172257         CDS       T02910                                 
Symbol
TOMM40
Name
(RefSeq) mitochondrial import receptor subunit TOM40 homolog
  KO
K11518  mitochondrial import receptor subunit TOM40
Organism
chx  Capra hircus (goat)
Pathway
chx04137  Mitophagy - animal
chx05014  Amyotrophic lateral sclerosis
chx05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102172257 (TOMM40)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102172257 (TOMM40)
   05022 Pathways of neurodegeneration - multiple diseases
    102172257 (TOMM40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:chx03029]
    102172257 (TOMM40)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:chx02000]
    102172257 (TOMM40)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    102172257 (TOMM40)
Transporters [BR:chx02000]
 Other transporters
  Primary active transporters [TC:3]
   102172257 (TOMM40)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 102172257
NCBI-ProteinID: XP_017918049
LinkDB
Position
18:53676189..53687865
AA seq 400 aa
MGSVGRGDRGGGGGSGFGCAWPTVWERSPDREEALPRATMGNVLAASSPPAGPPPPPAPP
LVGLPPPPPSPPGFTLPPLGGGLGAGAGTGRGSERTPGTAAASAGGTGDDGACGCLPNPG
TFEECHRKCKELFPVQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQL
SPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTA
AVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGAVMSLAGKYTLNNWLA
TVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSN
WIVGATMEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgggctctgtggggcggggcgaccgtggcggcggcggcggcagcgggttcggttgcgcg
tggcccacggtgtgggagcggagcccggaccgggaggaggcgctaccgcgcgcgaccatg
gggaacgtattggcagctagctcgccgcccgcagggccgccgccgccgcctgcgcctccc
ctcgtgggactgccgccacctccgccctctcctcccggcttcactttgccgccactcggg
ggtggcctgggcgctggggctggcacaggtcgaggttccgaacgcacccccgggactgcg
gctgccagcgctggagggactggggacgatggggcctgtggctgcctgcccaacccgggc
acgttcgaggagtgccaccggaagtgcaaggagctgtttcctgttcagatggagggtgtg
aagctcacagtcaacaaagggttgagtaatcacttccaggtgaaccacacagtagccctc
agcacaatcggggagtccaactaccacttcggggtgacgtacgtggggacgaagcagctg
agtcccacggaggcattccccgtgctggtgggtgacatggataatagtggcagcctcaat
gctcaggtcattcatcagctgggccctggcctcaggtccaagatggccatccagacccag
cagtcgaagtttgtgaactggcaggtggatggggagtaccggggttctgacttcacagca
gccgtcactttggggaacccagacgtcctggtgggttcagggatcctcgtggcccactac
ctccagagcatcacgccgtgcctggccctgggcggagagctggtctaccaccggcggccc
ggggaggagggcgctgttatgtcgctagctgggaaatacacattgaacaactggttggcg
acagtaacattgggtcaggcgggcatgcatgcaacgtattaccacaaagccagtgaccag
ctgcaggtgggtgtggagtttgaggccagcacaaggatgcaggacacaagtgtctccttt
gggtaccagctggacctgcccaaggccaacctcctcttcaaaggctctgtggacagcaac
tggatcgtgggcgccacaatggagaagaagctccctccgctgcccctgacgctggccctc
ggggccttcctgaatcaccgaaagaacaagttccagtgcggcttcggcctcaccattggc
tga

DBGET integrated database retrieval system